(data stored in ACNUC7421 zone)

EMBL: AM946981.INT_1

AM946981.INT_1       Location/Qualifiers
FT   CDS             complement(753074..753997)
FT                   /transl_table=11
FT                   /gene="int_1"
FT                   /locus_tag="B21_00705"
FT                   /product="enterobacteria phage lambda, integration protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00705"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31222"
FT                   /protein_id="CAQ31222.2"
FT                   /translation="MGRRRSHERRDLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAI
FT                   TEAIQANIELFSGHKHKPLTARINSDNSVTLHSWLDRYEKILASRGIKQKTLINYMSKI
FT                   KAIRRGLPDAPLEDITTKEIAAMLNGYIDEGKAASAKLIRSTLSDAFREAIAEGHITTN
FT                   HVAATRAAKSEVRRSRLTADEYLKIYQAAESSPCWLRLAMELAVVTGQRVGDLCEMKWS
FT                   DIVDGYLYVEQSKTGVKIAIPTALHIDALGISMKETLDKCKEILGGETIIASTRREPLS
FT                   SGTVSRYFMRARKASGLSFEGDPESY"
     MGRRRSHERR DLPPNLYIRN NGYYCYRDPR TGKEFGLGRD RRIAITEAIQ ANIELFSGHK        60
     HKPLTARINS DNSVTLHSWL DRYEKILASR GIKQKTLINY MSKIKAIRRG LPDAPLEDIT       120
     TKEIAAMLNG YIDEGKAASA KLIRSTLSDA FREAIAEGHI TTNHVAATRA AKSEVRRSRL       180
     TADEYLKIYQ AAESSPCWLR LAMELAVVTG QRVGDLCEMK WSDIVDGYLY VEQSKTGVKI       240
     AIPTALHIDA LGISMKETLD KCKEILGGET IIASTRREPL SSGTVSRYFM RARKASGLSF       300
     EGDPESY                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page