(data stored in ACNUC7421 zone)

EMBL: AM946981.IRAP

AM946981.IRAP        Location/Qualifiers
FT   CDS             366005..366265
FT                   /transl_table=11
FT                   /gene="iraP"
FT                   /locus_tag="B21_00333"
FT                   /product="anti-adaptor protein for sigma[S] stabilization"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00333"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30850"
FT                   /protein_id="CAQ30850.1"
FT                   /translation="MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQ
FT                   QRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPRQ"
     MKNLIAELLF KLAQKEEESK ELCAQVEALE IIVTAMLRNM AQNDQQRLID QVEGALYEVK        60
     PDASIPDDDT ELLRDYVKKL LKHPRQ                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page