(data stored in ACNUC7421 zone)

EMBL: AM946981.KDPC

AM946981.KDPC        Location/Qualifiers
FT   CDS             complement(684275..684847)
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="B21_00644"
FT                   /product="kdpC, subunit of potassium ion P-type ATPase
FT                   transporter"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00644"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31161"
FT                   /protein_id="CAQ31161.1"
FT                   /translation="MRGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIRE
FT                   GDTVRGSALIGQNFTGNGYFQGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAA
FT                   LRAANPDASTNVPVELVTASASGLDNNITPQAAVWQIPRVAKARNLSVEQLTQLIAKYS
FT                   QQPLVKYIGQPVVNIVELNLALDKLDE"
     MRGLRPALST FIFLLLITGG VYPLLTTVLG QWWFPWQANG SLIREGDTVR GSALIGQNFT        60
     GNGYFQGRPS ATAEMPYNPQ ASGGSNLAVS NPELDKQIAA RVAALRAANP DASTNVPVEL       120
     VTASASGLDN NITPQAAVWQ IPRVAKARNL SVEQLTQLIA KYSQQPLVKY IGQPVVNIVE       180
     LNLALDKLDE                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page