(data stored in ACNUC7421 zone)

EMBL: AM946981.LTAE

AM946981.LTAE        Location/Qualifiers
FT   CDS             complement(912991..913992)
FT                   /transl_table=11
FT                   /gene="ltaE"
FT                   /locus_tag="B21_00881"
FT                   /product="LtaA, subunit of low-specificity L-threonine
FT                   aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /EC_number="4.1.2.26"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00881"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31398"
FT                   /protein_id="CAQ31398.1"
FT                   /translation="MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAE
FT                   LSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPID
FT                   AAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKMLPREYLKEAWEFTRERNLAL
FT                   HVDGARIFNAVVAYGCELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRK
FT                   MAGGGMRQSGILAAAGMYALKNNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVR
FT                   VGEENAAALGEYMKARNVLINASPIVRLVTHLDVSREQLAEVAAHWRAFLAR"
     MIDLRSDTVT RPSRAMLEAM MAAPVGDDVY GDDPTVNALQ DYAAELSGKE AAIFLPTGTQ        60
     ANLVALLSHC ERGEEYIVGQ AAHNYLFEAG GAAVLGSIQP QPIDAAADGT LPLDKVAMKI       120
     KPDDIHFART KLLSLENTHN GKMLPREYLK EAWEFTRERN LALHVDGARI FNAVVAYGCE       180
     LKEITQYCDS FTICLSKGLG TPVGSLLVGN RDYIKRAIRW RKMAGGGMRQ SGILAAAGMY       240
     ALKNNVARLQ EDHDNAAWMA EQLREAGADV MRQDTNMLFV RVGEENAAAL GEYMKARNVL       300
     INASPIVRLV THLDVSREQL AEVAAHWRAF LAR                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page