(data stored in ACNUC7421 zone)

EMBL: AM946981.MDLA

AM946981.MDLA        Location/Qualifiers
FT   CDS             437911..439683
FT                   /transl_table=11
FT                   /gene="mdlA"
FT                   /locus_tag="B21_00404"
FT                   /product="predicted multidrug transporter subunit of ABC
FT                   superfamily: ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00404"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30921"
FT                   /protein_id="CAQ30921.1"
FT                   /translation="MRLFAQLSWYFRREWRRYLGAVALLVIIAMLQLVPPKVVGIVVDG
FT                   VTEQHFTTGLILMWIATMVLIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSRQH
FT                   PEFYLRHRTGDLMARATNDVDRVVFAAGEGVLTLVDSLVMGCAVLIMMSTQISWQLTLF
FT                   ALLPMPVMAIMIKRNGDALHERFKLAQAAFSSLNDRTQESLTSIRMIKAFGLEDRQSAL
FT                   FAADAEDTGKKNMRVARIDARFDPTIYIAIGMANLLAIGGGSWMVVQGSLTLGQLTSFM
FT                   MYLGLMIWPMLALAWMFNIVERGSAAYSRIRAMLAEAPVVNDGSEPVPEGRGELDVNIH
FT                   QFTYPQTDHPALENVNFALKPGQMLGICGPTGSGKSTLLSLIQRHFDVSEGDIRFHDIP
FT                   LTKLQLDSWRSRLAVVSQTPFLFSDTVANNIALGCPNATQQEIEHVARLASVHDDILRL
FT                   PQGYDTEVGERGVMLSGGQKQRISIARALLVNAEILILDDALSAVDGRTEHQILHNLRQ
FT                   WGQGRTVIISAHRLSALTEASEIIVMQHGHIAQRGNHDELAQQSGWYRDMYRYQQLEAA
FT                   LDDAPEIREEAVDA"
     MRLFAQLSWY FRREWRRYLG AVALLVIIAM LQLVPPKVVG IVVDGVTEQH FTTGLILMWI        60
     ATMVLIAVVV YLLRYVWRVL LFGASYQLAV ELREDYYRQL SRQHPEFYLR HRTGDLMARA       120
     TNDVDRVVFA AGEGVLTLVD SLVMGCAVLI MMSTQISWQL TLFALLPMPV MAIMIKRNGD       180
     ALHERFKLAQ AAFSSLNDRT QESLTSIRMI KAFGLEDRQS ALFAADAEDT GKKNMRVARI       240
     DARFDPTIYI AIGMANLLAI GGGSWMVVQG SLTLGQLTSF MMYLGLMIWP MLALAWMFNI       300
     VERGSAAYSR IRAMLAEAPV VNDGSEPVPE GRGELDVNIH QFTYPQTDHP ALENVNFALK       360
     PGQMLGICGP TGSGKSTLLS LIQRHFDVSE GDIRFHDIPL TKLQLDSWRS RLAVVSQTPF       420
     LFSDTVANNI ALGCPNATQQ EIEHVARLAS VHDDILRLPQ GYDTEVGERG VMLSGGQKQR       480
     ISIARALLVN AEILILDDAL SAVDGRTEHQ ILHNLRQWGQ GRTVIISAHR LSALTEASEI       540
     IVMQHGHIAQ RGNHDELAQQ SGWYRDMYRY QQLEAALDDA PEIREEAVDA                  590
//

If you have problems or comments...

PBIL Back to PBIL home page