(data stored in ACNUC7421 zone)

EMBL: AM946981.MHPB

AM946981.MHPB        Location/Qualifiers
FT   CDS             339806..340750
FT                   /transl_table=11
FT                   /gene="mhpB"
FT                   /locus_tag="B21_00306"
FT                   /product="3-(2,3-dihydroxyphenyl)propionate dioxygenase
FT                   monomer, subunit of 3-(2,3-dihydroxyphenyl)propionate
FT                   dioxygenase"
FT                   /EC_number="1.13.11.16"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00306"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30823"
FT                   /protein_id="CAQ30823.1"
FT                   /translation="MHAYLHCLSHSPLVGYVDPAQEVLDEVNGVIASARERIAAFSPEL
FT                   VVLFAPDHYNGFFYDVMPPFCLGVGATAIGDFGSAAGELPVPVELAEACAHAVMKSGID
FT                   LAVSYCMQVDHGFAQPLEFLLGGLDKVPVLPVFINGVATPLPGFQRTRMLGEAIGRFTS
FT                   TLNKRVLFLGSGGLSHQPPVPELAKADAHMRDRLLGSGKDLPASERELRQQRVISAAEK
FT                   FVEDQRTLHPLNPIWDNQFMTLLEQGRIQELDAVSNEELSAIAGKSTHEIKTWVAAFAA
FT                   ISAFGNWRSEGRYYRPIPEWIAGFGSLSARTEN"
     MHAYLHCLSH SPLVGYVDPA QEVLDEVNGV IASARERIAA FSPELVVLFA PDHYNGFFYD        60
     VMPPFCLGVG ATAIGDFGSA AGELPVPVEL AEACAHAVMK SGIDLAVSYC MQVDHGFAQP       120
     LEFLLGGLDK VPVLPVFING VATPLPGFQR TRMLGEAIGR FTSTLNKRVL FLGSGGLSHQ       180
     PPVPELAKAD AHMRDRLLGS GKDLPASERE LRQQRVISAA EKFVEDQRTL HPLNPIWDNQ       240
     FMTLLEQGRI QELDAVSNEE LSAIAGKSTH EIKTWVAAFA AISAFGNWRS EGRYYRPIPE       300
     WIAGFGSLSA RTEN                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page