(data stored in ACNUC7421 zone)

EMBL: AM946981.MOAE

AM946981.MOAE        Location/Qualifiers
FT   CDS             803282..803734
FT                   /transl_table=11
FT                   /gene="moaE"
FT                   /locus_tag="B21_00769"
FT                   /product="molybdopterin synthase large subunit, subunit of
FT                   molybdopterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00769"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31286"
FT                   /protein_id="CAQ31286.1"
FT                   /translation="MAETKIVVGPQPFSVGEEYPWLAERDEDGAVVTFTGKVRNHNLGD
FT                   SVKALTLEHYPGMTEKALAEIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSEHR
FT                   SSAFEAGQFIMDYLKTRAPFWKREATPEGDRWVEARESDQQAAKRW"
     MAETKIVVGP QPFSVGEEYP WLAERDEDGA VVTFTGKVRN HNLGDSVKAL TLEHYPGMTE        60
     KALAEIVDEA RNRWPLGRVT VIHRIGELWP GDEIVFVGVT SEHRSSAFEA GQFIMDYLKT       120
     RAPFWKREAT PEGDRWVEAR ESDQQAAKRW                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page