(data stored in ACNUC7421 zone)

EMBL: AM946981.MOKC

AM946981.MOKC        Location/Qualifiers
FT   CDS             complement(16749..16958)
FT                   /transl_table=11
FT                   /gene="mokC"
FT                   /locus_tag="B21_00018"
FT                   /product="regulatory peptide whose translation enables hokC
FT                   (gef) expression"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00018"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30535"
FT                   /protein_id="CAQ30535.1"
FT                   /translation="MLNTCRVPLTDRKVKEKRAMKQHKAMIVALIVICITAVVAALVTR
FT                   KDLCEVHIRTGQTEVAVFTAYESE"
     MLNTCRVPLT DRKVKEKRAM KQHKAMIVAL IVICITAVVA ALVTRKDLCE VHIRTGQTEV        60
     AVFTAYESE                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page