(data stored in SCRATCH zone)

EMBL: AM946981.NFSB

AM946981.NFSB        Location/Qualifiers
FT   CDS             complement(563434..564087)
FT                   /transl_table=11
FT                   /gene="nfsB"
FT                   /locus_tag="B21_00528"
FT                   /product="dihydropteridine reductase monomer, subunit of
FT                   dihydropteridine reductase"
FT                   /EC_number="1.5.1.34"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00528"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31045"
FT                   /protein_id="CAQ31045.1"
FT                   /translation="MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQP
FT                   WHFIVASTEEGKARVAKSAAGNYVFNERKILDASYVVVFCAKTAMDDAWLKLVVDQEDA
FT                   DGRFATPEAKAANDKGRKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVP
FT                   IEGFDAAILDAEFGLKEKGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV"
     MDIISVALKR HSTKAFDASK KLTPEQAEQI KTLLQYSPSS TNSQPWHFIV ASTEEGKARV        60
     AKSAAGNYVF NERKILDASY VVVFCAKTAM DDAWLKLVVD QEDADGRFAT PEAKAANDKG       120
     RKFFADMHRK DLHDDAEWMA KQVYLNVGNF LLGVAALGLD AVPIEGFDAA ILDAEFGLKE       180
     KGYTSLVVVP VGHHSVEDFN ATLPKSRLPQ NITLTEV                                217
//

If you have problems or comments...

PBIL Back to PBIL home page