(data stored in SCRATCH zone)

EMBL: AM946981.NU1

AM946981.NU1         Location/Qualifiers
FT   CDS             768659..769204
FT                   /transl_table=11
FT                   /gene="nu1"
FT                   /locus_tag="B21_00730"
FT                   /product="DLP12 prophage; DNA packaging protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31247"
FT                   /protein_id="CAQ31247.2"
FT                   /translation="MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAA
FT                   VIKWYAERDAEIENEKLRREVEELRQASEADLQPGTIEYERHRLTRAQADAQELKNARD
FT                   SAEVVETAFCTFVLSRIAGEIASILDGLPLSVQRRFPELENRHVDFLKRDIIKAMNKAA
FT                   ALDELIPGLLSEYIEQSG"
     MEVNKKQLAD IFGASIRTIQ NWQEQGMPVL RGGGKGNEVL YDSAAVIKWY AERDAEIENE        60
     KLRREVEELR QASEADLQPG TIEYERHRLT RAQADAQELK NARDSAEVVE TAFCTFVLSR       120
     IAGEIASILD GLPLSVQRRF PELENRHVDF LKRDIIKAMN KAAALDELIP GLLSEYIEQS       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page