(data stored in ACNUC7421 zone)

EMBL: AM946981.NU3

AM946981.NU3         Location/Qualifiers
FT   CDS             773600..774205
FT                   /transl_table=11
FT                   /gene="nu3"
FT                   /locus_tag="B21_00735"
FT                   /product="enterobacteria phage lambda, capsid assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00735"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31252"
FT                   /protein_id="CAQ31252.1"
FT                   /translation="MDATRQMFAQKVSAYTGLSVQVVLDTEAAVYSGQEAIDAGLADEL
FT                   VNSTDAITVMRDALDARKSRLSGGRMTKETQSTTVSATASQADVTDVVPATEGENASAA
FT                   QPDVNAQITAAVAAENSRIMGILNCEEAHGREEQARVLAETPGMTVKTARRILAAAPQS
FT                   AQARSDTALDRLMQGAPAPLAAGNPASDAVNDLLNTPV"
     MDATRQMFAQ KVSAYTGLSV QVVLDTEAAV YSGQEAIDAG LADELVNSTD AITVMRDALD        60
     ARKSRLSGGR MTKETQSTTV SATASQADVT DVVPATEGEN ASAAQPDVNA QITAAVAAEN       120
     SRIMGILNCE EAHGREEQAR VLAETPGMTV KTARRILAAA PQSAQARSDT ALDRLMQGAP       180
     APLAAGNPAS DAVNDLLNTP V                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page