(data stored in ACNUC7421 zone)

EMBL: AM946981.ORF61

AM946981.ORF61       Location/Qualifiers
FT   CDS             complement(755954..756139)
FT                   /transl_table=11
FT                   /gene="orf61"
FT                   /locus_tag="B21_00709"
FT                   /product="enterobacteria phage lambda, hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00709"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31226"
FT                   /protein_id="CAQ31226.1"
FT                   /translation="MRETRYDNHGMHFSGSGLHILCAYACRHGTCSMTPQQENALRSIA
FT                   RQANSEIKKSQTAVSG"
     MRETRYDNHG MHFSGSGLHI LCAYACRHGT CSMTPQQENA LRSIARQANS EIKKSQTAVS        60
     G                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page