(data stored in ACNUC7421 zone)

EMBL: AM946981.ORF63

AM946981.ORF63       Location/Qualifiers
FT   CDS             complement(756120..756311)
FT                   /transl_table=11
FT                   /gene="orf63"
FT                   /locus_tag="B21_00710"
FT                   /product="enterobacteria phage lambda, hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31227"
FT                   /protein_id="CAQ31227.1"
FT                   /translation="MHKASSVELRTSIEMAHSLAQIGIRFVPIPVETDEEFHTLAASLS
FT                   QKLEMMVAKAEADERDQV"
     MHKASSVELR TSIEMAHSLA QIGIRFVPIP VETDEEFHTL AASLSQKLEM MVAKAEADER        60
     DQV                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page