(data stored in ACNUC7421 zone)

EMBL: AM946981.PAGP

AM946981.PAGP        Location/Qualifiers
FT   CDS             616917..617477
FT                   /transl_table=11
FT                   /gene="pagP"
FT                   /locus_tag="B21_00581"
FT                   /product="PagP monomer, subunit of palmitoyl transferase
FT                   for Lipid A"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00581"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31098"
FT                   /protein_id="CAQ31098.1"
FT                   /translation="MNVSKYVAIFSFVFIQLISVGKVFANADEWMTTFRENIAQTWQQP
FT                   EHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWN
FT                   KWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTF
FT                   QMTYIPGTYNNGNVYFAWMRFQF"
     MNVSKYVAIF SFVFIQLISV GKVFANADEW MTTFRENIAQ TWQQPEHYDL YIPAITWHAR        60
     FAYDKEKTDR YNERPWGGGF GLSRWDEKGN WHGLYAMAFK DSWNKWEPIA GYGWESTWRP       120
     LADENFHLGL GFTAGVTARD NWNYIPLPVL LPLASVGYGP VTFQMTYIPG TYNNGNVYFA       180
     WMRFQF                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page