(data stored in ACNUC7421 zone)

EMBL: AM946981.PANB

AM946981.PANB        Location/Qualifiers
FT   CDS             complement(151611..152405)
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="B21_00132"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase
FT                   monomer, subunit of 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00132"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30649"
FT                   /protein_id="CAQ30649.1"
FT                   /translation="MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFADEGLNVMLVGD
FT                   SLGMTVQGHDSTLPVTVADIAYHTAAVRRGAPNCLLLADLPFMAYATPEQAFENAATVM
FT                   RAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEAGDQL
FT                   LSDALALEAAGAQLLVLECVPVELAKRITEALAIPVIGIGAGNVTDGQILVMHDAFGIT
FT                   GGHIPKFAKNFLAETGDIRAAVRQYMAEVESGVYPGEEHSFH"
     MKPTTIASLQ KCKQDKKRFA TITAYDYSFA KLFADEGLNV MLVGDSLGMT VQGHDSTLPV        60
     TVADIAYHTA AVRRGAPNCL LLADLPFMAY ATPEQAFENA ATVMRAGANM VKIEGGEWLV       120
     ETVQMLTERA VPVCGHLGLT PQSVNIFGGY KVQGRGDEAG DQLLSDALAL EAAGAQLLVL       180
     ECVPVELAKR ITEALAIPVI GIGAGNVTDG QILVMHDAFG ITGGHIPKFA KNFLAETGDI       240
     RAAVRQYMAE VESGVYPGEE HSFH                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page