(data stored in ACNUC7421 zone)

EMBL: AM946981.POXB

AM946981.POXB        Location/Qualifiers
FT   CDS             complement(914029..915747)
FT                   /transl_table=11
FT                   /gene="poxB"
FT                   /locus_tag="B21_00882"
FT                   /product="pyruvate oxidase monomer, subunit of pyruvate
FT                   oxidase / acetoin synthesis"
FT                   /EC_number="1.2.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00882"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31399"
FT                   /protein_id="CAQ31399.1"
FT                   /translation="MKQTVAAYIAKTLESAGVKRIWGVTGDSLNGLSDSLNRMGTIEWM
FT                   STRHEEVAAFAAGAEAQLSGELAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAAHIPS
FT                   SEIGSGYFQETHPQELFRECSHYCELVSSPEQIPQVLAIAMRKAVLNRGVSIVVLPGDV
FT                   ALKPAPEGATMHWYHAPQPVVTPEEEELRKLAQLLRYSSNIALMCGSGCAGAHKELVEF
FT                   AGKIKAPIVHALRGKEHVEYDNPYDVGMTGLIGFSSGFHTMMNADTLVLLGTQFPYRAF
FT                   YPTDAKIIQIDINPASIGAHSKVDMALVGDIKSTLRALLPLVEEKADRKFLDKALEDYR
FT                   DARKGLDDLAKPSEKAIHPQYLAQQISHFAADDAIFTCDVGTPTVWAARYLKMNGKRRL
FT                   LGSFNHGSMANAMPQALGAQATEPERQVVAMCGDGGFSMLMGDFLSVVQMKLPVKIVVF
FT                   NNSVLGFVAMEMKAGGYLTDGTELHDTNFARIAEACGITGIRVEKASEVDEALQRAFSI
FT                   DGPVLVDVVVAKEELAIPPQIKLEQAKGFSLYMLRAIISGRGDEVIELAKTNWLR"
     MKQTVAAYIA KTLESAGVKR IWGVTGDSLN GLSDSLNRMG TIEWMSTRHE EVAAFAAGAE        60
     AQLSGELAVC AGSCGPGNLH LINGLFDCHR NHVPVLAIAA HIPSSEIGSG YFQETHPQEL       120
     FRECSHYCEL VSSPEQIPQV LAIAMRKAVL NRGVSIVVLP GDVALKPAPE GATMHWYHAP       180
     QPVVTPEEEE LRKLAQLLRY SSNIALMCGS GCAGAHKELV EFAGKIKAPI VHALRGKEHV       240
     EYDNPYDVGM TGLIGFSSGF HTMMNADTLV LLGTQFPYRA FYPTDAKIIQ IDINPASIGA       300
     HSKVDMALVG DIKSTLRALL PLVEEKADRK FLDKALEDYR DARKGLDDLA KPSEKAIHPQ       360
     YLAQQISHFA ADDAIFTCDV GTPTVWAARY LKMNGKRRLL GSFNHGSMAN AMPQALGAQA       420
     TEPERQVVAM CGDGGFSMLM GDFLSVVQMK LPVKIVVFNN SVLGFVAMEM KAGGYLTDGT       480
     ELHDTNFARI AEACGITGIR VEKASEVDEA LQRAFSIDGP VLVDVVVAKE ELAIPPQIKL       540
     EQAKGFSLYM LRAIISGRGD EVIELAKTNW LR                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page