(data stored in ACNUC7421 zone)

EMBL: AM946981.PSIF

AM946981.PSIF        Location/Qualifiers
FT   CDS             367900..368220
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="B21_00335"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00335"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30852"
FT                   /protein_id="CAQ30852.1"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAERTLTPQQQHMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
     MKITLLVTLL FGLVFLTTVG AAERTLTPQQ QHMTSCNQQA TAQALKGDAR KTYMSDCLKN        60
     SKSAPGEKSL TPQQQKMREC NNQATQQSLK GDDRNKFMSA CLKKAA                      106
//

If you have problems or comments...

PBIL Back to PBIL home page