(data stored in ACNUC7421 zone)

EMBL: AM946981.RAL

AM946981.RAL         Location/Qualifiers
FT   CDS             complement(759202..759402)
FT                   /transl_table=11
FT                   /gene="ral"
FT                   /locus_tag="B21_00718"
FT                   /product="enterobacteria phage lambda, restriction
FT                   alleviation protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00718"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31235"
FT                   /protein_id="CAQ31235.1"
FT                   /translation="MTTTIDKNQWCGQFKRCNGCKLQSECMVKPEEMFPVMEDGKYVDK
FT                   WAIRTTAMIARELGKQNNKAA"
     MTTTIDKNQW CGQFKRCNGC KLQSECMVKP EEMFPVMEDG KYVDKWAIRT TAMIARELGK        60
     QNNKAA                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page