(data stored in ACNUC7421 zone)

EMBL: AM946981.RIMO

AM946981.RIMO        Location/Qualifiers
FT   CDS             complement(860623..861948)
FT                   /transl_table=11
FT                   /gene="rimO"
FT                   /locus_tag="B21_00819"
FT                   /product="ribosomal protein S12 D88 methylthiotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00819"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31336"
FT                   /protein_id="CAQ31336.1"
FT                   /translation="MSKVTPQPKIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDA
FT                   DMVIVNTCGFIDSAVQESLEAIGEALNENGKVIVTGCLGAKEDQIREVHPKVLEITGPH
FT                   SYEQVLEHVHHYVPKPKHNPFLSLVPEQGVKLTPRHYAYLKISEGCNHRCTFCIIPSMR
FT                   GDLVSRPIGEVLSEAKRLVDAGVKEILVISQDTSAYGVDVKHRTGFHNGEPVKTSMVSL
FT                   CEQLSKLGIWTRLHYVYPYPHVDDVIPLMAEGKILPYLDIPLQHASPRILKLMKRPGSV
FT                   DRQLARIKQWREICPELTLRSTFIVGFPGETEEDFQMLLDFLKEARLDRVGCFKYSPVE
FT                   GADANALPDQVPEEVKEERWNRFMQLQQQISAERLQEKVGREILVIIDEVDEEGAIGRS
FT                   MADAPEIDGAVYLNGETNVKPGDILRVKVEHADEYDLWGSRV"
     MSKVTPQPKI GFVSLGCPKN LVDSERILTE LRTEGYDVVP SYDDADMVIV NTCGFIDSAV        60
     QESLEAIGEA LNENGKVIVT GCLGAKEDQI REVHPKVLEI TGPHSYEQVL EHVHHYVPKP       120
     KHNPFLSLVP EQGVKLTPRH YAYLKISEGC NHRCTFCIIP SMRGDLVSRP IGEVLSEAKR       180
     LVDAGVKEIL VISQDTSAYG VDVKHRTGFH NGEPVKTSMV SLCEQLSKLG IWTRLHYVYP       240
     YPHVDDVIPL MAEGKILPYL DIPLQHASPR ILKLMKRPGS VDRQLARIKQ WREICPELTL       300
     RSTFIVGFPG ETEEDFQMLL DFLKEARLDR VGCFKYSPVE GADANALPDQ VPEEVKEERW       360
     NRFMQLQQQI SAERLQEKVG REILVIIDEV DEEGAIGRSM ADAPEIDGAV YLNGETNVKP       420
     GDILRVKVEH ADEYDLWGSR V                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page