(data stored in ACNUC7421 zone)

EMBL: AM946981.RPST

AM946981.RPST        Location/Qualifiers
FT   CDS             complement(24887..25150)
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="B21_00026"
FT                   /product="30S ribosomal subunit protein S20, subunit of 30S
FT                   ribosomal subunit and ribosome"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00026"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30543"
FT                   /protein_id="CAQ30543.1"
FT                   /translation="MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
     MANIKSAKKR AIQSEKARKH NASRRSMMRT FIKKVYAAIE AGDKAAAQKA FNEMQPIVDR        60
     QAAKGLIHKN KAARHKANLT AQINKLA                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page