(data stored in ACNUC7421 zone)

EMBL: AM946981.TBPA

AM946981.TBPA        Location/Qualifiers
FT   CDS             complement(77302..78285)
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="B21_00069"
FT                   /product="thiamin-binding protein, subunit of thiamin ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00069"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30586"
FT                   /protein_id="CAQ30586.1"
FT                   /translation="MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPVVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAD
FT                   AVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTP
FT                   GLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   ILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWM
FT                   YPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
     MLKKCLPLLL LCTAPVFAKP VLTVYTYDSF AADWGPGPVV KKAFEADCNC ELKLVALEDG        60
     VSLLNRLRME GKNSKADVVL GLDNNLLDAA SKTGLFAKSG VAADAVNVPG GWNNDTFVPF       120
     DYGYFAFVYD KNKLKNPPQS LKELVESDQN WRVIYQDPRT STPGLGLLLW MQKVYGDDAP       180
     QAWQKLAKKT VTVTKGWSEA YGLFLKGESD LVLSYTTSPA YHILEEKKDN YAAANFSEGH       240
     YLQVEVAART AASKQPELAQ KFLQFMVSPA FQNAIPTGNW MYPVANVTLP AGFEKLTKPA       300
     TTLEFTPAEV AAQRQAWISE WQRAVSR                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page