(data stored in ACNUC7421 zone)

EMBL: AM946981.TOLR

AM946981.TOLR        Location/Qualifiers
FT   CDS             734504..734932
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="B21_00687"
FT                   /product="tolR, subunit of The Tol-Pal Cell Envelope
FT                   Complex, Colicin S4 Transport System and The Colicin A
FT                   Import System"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00687"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31204"
FT                   /protein_id="CAQ31204.1"
FT                   /translation="MARARGRGRRDLKSEINIVPLLDVLLVLLLIFMATAPIITQSVEV
FT                   DLPDATESQAVSSNDNPPVIVEVSGIGQYTVVVKKDRLERLPPEQVVAEVSSRFKANPK
FT                   TVFLIGGAKDVPYDEIIKALNLLHSAGVKSVGLMTQPI"
     MARARGRGRR DLKSEINIVP LLDVLLVLLL IFMATAPIIT QSVEVDLPDA TESQAVSSND        60
     NPPVIVEVSG IGQYTVVVKK DRLERLPPEQ VVAEVSSRFK ANPKTVFLIG GAKDVPYDEI       120
     IKALNLLHSA GVKSVGLMTQ PI                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page