(data stored in ACNUC7421 zone)

EMBL: AM946981.TOMB

AM946981.TOMB        Location/Qualifiers
FT   CDS             complement(449374..449748)
FT                   /transl_table=11
FT                   /gene="tomB"
FT                   /locus_tag="B21_00417"
FT                   /product="protein that modulates Hha toxicity"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00417"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30934"
FT                   /protein_id="CAQ30934.1"
FT                   /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAIN
FT                   LQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYLDDTFMLFSSYGINMQDLQKWRKSG
FT                   NRLFRCFVNATKENPASLSC"
     MDEYSPKRHD IAQLKFLCET LYHDCLANLE ESNHGWVNDP TSAINLQLNE LIEHIATFAL        60
     NYKIKYNEDN KLIEQIDEYL DDTFMLFSSY GINMQDLQKW RKSGNRLFRC FVNATKENPA       120
     SLSC                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page