(data stored in ACNUC7421 zone)

EMBL: AM946981.YACL

AM946981.YACL        Location/Qualifiers
FT   CDS             137192..137554
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="B21_00117"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00117"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30634"
FT                   /protein_id="CAQ30634.1"
FT                   /translation="MDYEFLRDITGVVKVRMSMGHEVVGHWFNEEVKENLALLDEVEQA
FT                   AHALKGSERSWQRAGHEYTLWMDGEEVMVRANQLEFAGDEMEEGMNYYDEESLSLCGVE
FT                   DFLQVVAAYRNFVQQK"
     MDYEFLRDIT GVVKVRMSMG HEVVGHWFNE EVKENLALLD EVEQAAHALK GSERSWQRAG        60
     HEYTLWMDGE EVMVRANQLE FAGDEMEEGM NYYDEESLSL CGVEDFLQVV AAYRNFVQQK       120
//

If you have problems or comments...

PBIL Back to PBIL home page