(data stored in ACNUC7421 zone)

EMBL: AM946981.YADC

AM946981.YADC        Location/Qualifiers
FT   CDS             complement(152518..153792)
FT                   /transl_table=11
FT                   /gene="yadC"
FT                   /locus_tag="B21_00133"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00133"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30650"
FT                   /protein_id="CAQ30650.2"
FT                   /translation="MKKFFRHFLFLILCLSCYTASAGTDDNVGYIVGNSYGVGPSDQKW
FT                   RETGPNGDATVIFRYATSTNNLVFYKPTQLGPTGVKLQWSQLDTASGGGFLYCNRSDST
FT                   SGSAMRIENAMVDSGKMYGSHKLFNTSVPGLYYTLLISNMWSAYGTVTNVSSPGIYIGD
FT                   SAEQYFSWYNPSEDVLYWSCNNANSTRKYWAVGGIYQTLTIEFYTDTNFDPTVTQQIKL
FT                   SSSSNYLYSFKAYGAGQGINEHSYFIKIDFDLLNVKLTNPTCFTAMLSGTSVTGSTVKM
FT                   GEYSAEQIRNGATPVPFDISLQNCVRVTNIETKLVSTKVGTENGQLLGNTLTGNDAAKG
FT                   VGVLIEGLATSKNPLMTLKPNDSNSVYKDYDPRGKDDTTGGVYPDQDTGITYPLHFQAT
FT                   LQQDGTIPIEAGEFKATSTFQVTYP"
     MKKFFRHFLF LILCLSCYTA SAGTDDNVGY IVGNSYGVGP SDQKWRETGP NGDATVIFRY        60
     ATSTNNLVFY KPTQLGPTGV KLQWSQLDTA SGGGFLYCNR SDSTSGSAMR IENAMVDSGK       120
     MYGSHKLFNT SVPGLYYTLL ISNMWSAYGT VTNVSSPGIY IGDSAEQYFS WYNPSEDVLY       180
     WSCNNANSTR KYWAVGGIYQ TLTIEFYTDT NFDPTVTQQI KLSSSSNYLY SFKAYGAGQG       240
     INEHSYFIKI DFDLLNVKLT NPTCFTAMLS GTSVTGSTVK MGEYSAEQIR NGATPVPFDI       300
     SLQNCVRVTN IETKLVSTKV GTENGQLLGN TLTGNDAAKG VGVLIEGLAT SKNPLMTLKP       360
     NDSNSVYKDY DPRGKDDTTG GVYPDQDTGI TYPLHFQATL QQDGTIPIEA GEFKATSTFQ       420
     VTYP                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page