(data stored in SCRATCH zone)

EMBL: AM946981.YAEH

AM946981.YAEH        Location/Qualifiers
FT   CDS             complement(186546..186932)
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="B21_00161"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00161"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30678"
FT                   /protein_id="CAQ30678.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKS
FT                   VKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDL
FT                   RHLESVVTNKISEIEADLEKLTRK"
     MYDNLKSLGI TNPEEIDRYS LRQEANNDIL KIYFQKDKGE FFAKSVKFKY PRQRKTVVAD        60
     GVGQGYKEVQ EISPNLRYII DELDQICQRD RSEVDLKRKI LDDLRHLESV VTNKISEIEA       120
     DLEKLTRK                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page