(data stored in ACNUC7421 zone)

EMBL: AM946981.YAEJ

AM946981.YAEJ        Location/Qualifiers
FT   CDS             217670..218092
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="B21_00189"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00189"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30706"
FT                   /protein_id="CAQ30706.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAVIKDLTTEQKA
FT                   RRPTRPTRASKERRLASKAQKSSVKALRGKVRSGRE"
     MIVISRHVAI PDGELEITAI RAQGAGGQHV NKTSTAIHLR FDIRASSLPE YYKERLLAAS        60
     HHLISSDGVI VIKAQEYRSQ ELNREAALAR LVAVIKDLTT EQKARRPTRP TRASKERRLA       120
     SKAQKSSVKA LRGKVRSGRE                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page