(data stored in ACNUC7421 zone)

EMBL: AM946981.YAEP

AM946981.YAEP        Location/Qualifiers
FT   CDS             complement(216762..216962)
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="B21_00187"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00187"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30704"
FT                   /protein_id="CAQ30704.1"
FT                   /translation="MEKYCELIRKRYAEIASGDLGYVPDALGCVLKVLNEMAADDALSE
FT                   AVREKAAYAAANLLVSDYVNE"
     MEKYCELIRK RYAEIASGDL GYVPDALGCV LKVLNEMAAD DALSEAVREK AAYAAANLLV        60
     SDYVNE                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page