(data stored in SCRATCH zone)

EMBL: AM946981.YAGS

AM946981.YAGS        Location/Qualifiers
FT   CDS             complement(271112..272068)
FT                   /transl_table=11
FT                   /gene="yagS"
FT                   /locus_tag="B21_00247"
FT                   /product="aldehyde ferredoxin oxidoreductase, FAD-binding
FT                   subunit, subunit of aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00247"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30764"
FT                   /protein_id="CAQ30764.1"
FT                   /translation="MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETP
FT                   THLIDVNGLGLDKIEVTDAGGLRIGALVRNTDLAAHERVRRDYAVLSRALLAGASGQLR
FT                   NQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPS
FT                   DMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPGELIIAVTLPPPL
FT                   GGKHIYRKVRDRASYAFALVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQA
FT                   VYDALFASAHPTAENTFKLLLAKRTLASVLAEARAQA"
     MKAFTYERVN TPAEAALSAQ RVPGAKFIAG GTNLLDLMKL EIETPTHLID VNGLGLDKIE        60
     VTDAGGLRIG ALVRNTDLAA HERVRRDYAV LSRALLAGAS GQLRNQATTA GNLLQRTRCP       120
     YFYDTNQPCN KRLPGSGCAA LEGFSRQHAV VGVSEACIAT HPSDMAVAMR LLDAVVETIT       180
     PEGKTRSITL ADFYHPPGKT PHIETALLPG ELIIAVTLPP PLGGKHIYRK VRDRASYAFA       240
     LVSVAAIIQP DGSGRVALGG VAHKPWRIEA ADAQLSQGAQ AVYDALFASA HPTAENTFKL       300
     LLAKRTLASV LAEARAQA                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page