(data stored in ACNUC7421 zone)

EMBL: AM946981.YAGV

AM946981.YAGV        Location/Qualifiers
FT   CDS             complement(274674..275384)
FT                   /transl_table=11
FT                   /gene="yagV"
FT                   /locus_tag="B21_00251"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00251"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30768"
FT                   /protein_id="CAQ30768.1"
FT                   /translation="MFRRRGVTLTKALLTAVCMLAAPLTQAISVGNLTFSLPSETDFVS
FT                   KRVVNNNKSARIYRIAISAIDSPGSSELRTRPVDGELLFAPRQLALQAGESEYFKFYYH
FT                   GPQDNRERYYRVSFREVPTRNQTRRSPTGGEVSTEPVVVMDTILVVRPRQVQFKWSFDK
FT                   VTGTVSNTGNTWFKLLIKPGCDSTEEEGDAWYLRPGDVVHQPELRQPGNHYLVYNDKFI
FT                   KISDSCPAKPPSAD"
     MFRRRGVTLT KALLTAVCML AAPLTQAISV GNLTFSLPSE TDFVSKRVVN NNKSARIYRI        60
     AISAIDSPGS SELRTRPVDG ELLFAPRQLA LQAGESEYFK FYYHGPQDNR ERYYRVSFRE       120
     VPTRNQTRRS PTGGEVSTEP VVVMDTILVV RPRQVQFKWS FDKVTGTVSN TGNTWFKLLI       180
     KPGCDSTEEE GDAWYLRPGD VVHQPELRQP GNHYLVYNDK FIKISDSCPA KPPSAD           236
//

If you have problems or comments...

PBIL Back to PBIL home page