(data stored in ACNUC7421 zone)

EMBL: AM946981.YAHE

AM946981.YAHE        Location/Qualifiers
FT   CDS             305547..306410
FT                   /transl_table=11
FT                   /gene="yahE"
FT                   /locus_tag="B21_00278"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00278"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30795"
FT                   /protein_id="CAQ30795.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFDDLFRHGDKVQFDDQGITVGQHLHIEMSRCRRWLSPTLQMTAVNF
FT                   HLIAWQQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVNEKQNIAAA
FT                   VASMMGLGIGLTPSADDYLTGLVLILFISGHPAEKYKEEFYRGLQRGRNNTTLLSAITL
FT                   EAALQQRCRENIHHFIHDIIYGVPGNSTQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
     MWALTADADF LAQRGQGQVE QVFARAVNIA LPARQQLLTL LCEEYDNAPN SCRLALTHFD        60
     DLFRHGDKVQ FDDQGITVGQ HLHIEMSRCR RWLSPTLQMT AVNFHLIAWQ QWHDIIHQHL       120
     GENETLFNYR GDNPFYQALN KELHIKRRAV IQAVNEKQNI AAAVASMMGL GIGLTPSADD       180
     YLTGLVLILF ISGHPAEKYK EEFYRGLQRG RNNTTLLSAI TLEAALQQRC RENIHHFIHD       240
     IIYGVPGNST QAIEKIKHIG SSSGCDMLYG MADGCALSQT YGGNYVS                     287
//

If you have problems or comments...

PBIL Back to PBIL home page