(data stored in SCRATCH zone)

EMBL: AM946981.YAHN

AM946981.YAHN        Location/Qualifiers
FT   CDS             complement(315289..315960)
FT                   /transl_table=11
FT                   /gene="yahN"
FT                   /locus_tag="B21_00287"
FT                   /product="predicted neutral amino acid efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00287"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30804"
FT                   /protein_id="CAQ30804.1"
FT                   /translation="MMKLLHLFMDEITMDPLHAVYLTVGLFVITFFNPGANLFVVVQTS
FT                   LASGRRAGVLTGLGVALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCS
FT                   MRRQSTPQMSTLQQPISAPWYVFFRRGLITDLSNPQTVLFFISIFSVTLNAETPTWARL
FT                   MAWAGIVLASIIWRVFLSQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEGVTQ
FT                   R"
     MMKLLHLFMD EITMDPLHAV YLTVGLFVIT FFNPGANLFV VVQTSLASGR RAGVLTGLGV        60
     ALGDAFYSGL GLFGLATLIT QCEEIFSLIR IVGGAYLLWF AWCSMRRQST PQMSTLQQPI       120
     SAPWYVFFRR GLITDLSNPQ TVLFFISIFS VTLNAETPTW ARLMAWAGIV LASIIWRVFL       180
     SQAFSLPAVR RAYGRMQRVA SRVIGAIIGV FALRLIYEGV TQR                         223
//

If you have problems or comments...

PBIL Back to PBIL home page