(data stored in ACNUC7421 zone)

EMBL: AM946981.YAHO

AM946981.YAHO        Location/Qualifiers
FT   CDS             316107..316382
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="B21_00288"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00288"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30805"
FT                   /protein_id="CAQ30805.1"
FT                   /translation="MKIISKMLVGALALAVTNVYAAELMTKAEFEKVESQYEKIGDIST
FT                   SNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTANIYKKK"
     MKIISKMLVG ALALAVTNVY AAELMTKAEF EKVESQYEKI GDISTSNEMS TADAKEDLIK        60
     KADEKGADVL VLTSGQTDNK IHGTANIYKK K                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page