(data stored in SCRATCH zone)

EMBL: AM946981.YAIA

AM946981.YAIA        Location/Qualifiers
FT   CDS             371598..371789
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="B21_00340"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30857"
FT                   /protein_id="CAQ30857.1"
FT                   /translation="MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAQEAMDAKKRYEDPDKE"
     MPTKPPYPRE AYIVTIEKGK PGQTVTWYQL RADHPKPDSL ISEHPTAQEA MDAKKRYEDP        60
     DKE                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page