(data stored in SCRATCH zone)

EMBL: AM946981.YAIE

AM946981.YAIE        Location/Qualifiers
FT   CDS             372796..373080
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="B21_00342"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00342"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30859"
FT                   /protein_id="CAQ30859.1"
FT                   /translation="MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEM
FT                   TVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL"
     MLQSNEYFSG KVKSIGFSSS STGRASVGVM VEGEYTFSTA EPEEMTVISG ALNVLLPDAT        60
     DWQVYEAGSV FNVPGHSEFH LQVAEPTSYL CRYL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page