(data stored in ACNUC7421 zone)

EMBL: AM946981.YAIL

AM946981.YAIL        Location/Qualifiers
FT   CDS             346101..346640
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="B21_00312"
FT                   /product="nucleoprotein/polynucleotide-associated enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00312"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30829"
FT                   /protein_id="CAQ30829.1"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQAQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQD
FT                   EDDPYADFKVPDDLMW"
     MAKLTLQEQL LKAGLVTSKK AAKVERTAKK SRVQAREARA AVEENKKAQL ERDKQLSEQQ        60
     KQAALAKEYK AQVKQLIEMN RITIANGDIG FNFTDGNLIK KIFVDKLTQA QLINGRLAIA       120
     RLLVDNNSEG EYAIIPASVA DKIAQRDASS IVLHSALSAE EQDEDDPYAD FKVPDDLMW        179
//

If you have problems or comments...

PBIL Back to PBIL home page