(data stored in SCRATCH zone)

EMBL: AM946981.YAJD

AM946981.YAJD        Location/Qualifiers
FT   CDS             396000..396347
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="B21_00362"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00362"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30879"
FT                   /protein_id="CAQ30879.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
     MAIIPKNYAR LESGYREKAL KIYPWVCGRC SREFVYSNLR ELTVHHIDHD HTNNPEDGSN        60
     WELLCLYCHD HEHSKYTEAD QYGTTVIAGE DAQKDVGEAK YNPFADLKAM MNKKK            115
//

If you have problems or comments...

PBIL Back to PBIL home page