(data stored in ACNUC7421 zone)

EMBL: AM946981.YAJQ

AM946981.YAJQ        Location/Qualifiers
FT   CDS             410078..410569
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="B21_00378"
FT                   /product="nucleotide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00378"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30895"
FT                   /protein_id="CAQ30895.1"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDAS
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIES
FT                   ATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD
FT                   "
     MPSFDIVSEV DLQEARNAVD NASREVESRF DFRNVEASFE LNDASKTIKV LSESDFQVNQ        60
     LLDILRAKLL KRGIEGSSLD VPENIVHSGK TWFVEAKLKQ GIESATQKKI VKMIKDSKLK       120
     VQAQIQGDEI RVTGKSRDDL QAVMAMVRGG DLGQPFQFKN FRD                         163
//

If you have problems or comments...

PBIL Back to PBIL home page