(data stored in SCRATCH zone)

EMBL: AM946981.YBAB

AM946981.YBAB        Location/Qualifiers
FT   CDS             463116..463445
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="B21_00427"
FT                   /product="conserved DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00427"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30944"
FT                   /protein_id="CAQ30944.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
     MFGKGGLGNL MKQAQQMQEK MQKMQEEIAQ LEVTGESGAG LVKVTINGAH NCRRVEIDPS        60
     LLEDDKEMLE DLVAAAFNDA ARRIEETQKE KMASVSSGMQ LPPGFKMPF                   109
//

If you have problems or comments...

PBIL Back to PBIL home page