(data stored in ACNUC7421 zone)

EMBL: AM946981.YBAM

AM946981.YBAM        Location/Qualifiers
FT   CDS             complement(459150..459311)
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="B21_00422"
FT                   /product="small protein involved in the cell envelope
FT                   stress response"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00422"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30939"
FT                   /protein_id="CAQ30939.1"
FT                   /translation="MSLENAPDDVKLAVDLIVLLEENQIPASTVLRALDIVKRDYEKKL
FT                   TRDDEAEK"
     MSLENAPDDV KLAVDLIVLL EENQIPASTV LRALDIVKRD YEKKLTRDDE AEK               53
//

If you have problems or comments...

PBIL Back to PBIL home page