(data stored in ACNUC7421 zone)

EMBL: AM946981.YBAN

AM946981.YBAN        Location/Qualifiers
FT   CDS             459922..460299
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="B21_00424"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00424"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30941"
FT                   /protein_id="CAQ30941.1"
FT                   /translation="MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGSYLRFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIMLLVI
FT                   LACLLFYMWRIPVIDEKQEKH"
     MQRIILIIIG WLAVVLGTLG VVLPVLPTTP FILLAAWCFA RSSPRFHAWL LYRSWFGSYL        60
     RFWQKHHAMP RGVKPRAILL ILLTFAISLW FVQMPWVRIM LLVILACLLF YMWRIPVIDE       120
     KQEKH                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page