(data stored in SCRATCH zone)

EMBL: AM946981.YBAV

AM946981.YBAV        Location/Qualifiers
FT   CDS             432965..433336
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="B21_00398"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00398"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30915"
FT                   /protein_id="CAQ30915.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAAPAAKPTTVETKAEAPAAQ
FT                   SKAAVLAKASDEEGTRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
     MKHGIKALLI TLSLACAGMS HSALAAAPAA KPTTVETKAE APAAQSKAAV LAKASDEEGT        60
     RVSINNASAE ELARAMNGVG LKKAQAIVSY REEYGPFKTV EDLKQVPGMG NSLVERNLAV       120
     LTL                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page