(data stored in ACNUC7421 zone)

EMBL: AM946981.YBBA

AM946981.YBBA        Location/Qualifiers
FT   CDS             488874..489560
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="B21_00451"
FT                   /product="ybbA, subunit of YbbA/YbbP ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00451"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30968"
FT                   /protein_id="CAQ30968.1"
FT                   /translation="MPAENIVEVHHLKKSVGQGEHELSILTGVELVVKRGETIALVGES
FT                   GSGKSTLLAILAGLDDGSSGEVSLVGQPLHNMDEEARAKLRAKHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGESSAESRNGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNG
FT                   RPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLIMVTHDLQLAARCDRCLRLVNG
FT                   QLQEEA"
     MPAENIVEVH HLKKSVGQGE HELSILTGVE LVVKRGETIA LVGESGSGKS TLLAILAGLD        60
     DGSSGEVSLV GQPLHNMDEE ARAKLRAKHV GFVFQSFMLI PTLNALENVE LPALLRGESS       120
     AESRNGAKAL LEQLGLGKRL DHLPAQLSGG EQQRVALARA FNGRPDVLFA DEPTGNLDRQ       180
     TGDKIADLLF SLNREHGTTL IMVTHDLQLA ARCDRCLRLV NGQLQEEA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page