(data stored in ACNUC7421 zone)

EMBL: AM946981.YBCJ

AM946981.YBCJ        Location/Qualifiers
FT   CDS             complement(525742..525954)
FT                   /transl_table=11
FT                   /gene="ybcJ"
FT                   /locus_tag="B21_00483"
FT                   /product="predicted RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00483"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31000"
FT                   /protein_id="CAQ31000.1"
FT                   /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAV
FT                   ETRKRCKIVAGQTVSFAGHSVQVVA"
     MATFSLGKHP HVELCDLLKL EGWSESGAQA KIAIAEGQVK VDGAVETRKR CKIVAGQTVS        60
     FAGHSVQVVA                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page