(data stored in ACNUC7421 zone)

EMBL: AM946981.YBCL

AM946981.YBCL        Location/Qualifiers
FT   CDS             539482..540033
FT                   /transl_table=11
FT                   /gene="ybcL"
FT                   /locus_tag="B21_00500"
FT                   /product="DLP12 prophage; predicted kinase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31017"
FT                   /protein_id="CAQ31017.1"
FT                   /translation="MKTLIVSTVLAFITFSAQAAAFQVTSNEIKTGEQLTTSHVFSGFG
FT                   CEGGNTSPSLTWSGVPEGTKSFAVTVYDPDAPTGSGWWHWTVVNIPATVTYLPVDAGRR
FT                   DGTKLPTGAVQGRNDFGYAGFGGACPPKGDKPHHYQFKVWALKTEKIPVDSNSSGALVG
FT                   YMLNANKIATAEITPVYEIK"
     MKTLIVSTVL AFITFSAQAA AFQVTSNEIK TGEQLTTSHV FSGFGCEGGN TSPSLTWSGV        60
     PEGTKSFAVT VYDPDAPTGS GWWHWTVVNI PATVTYLPVD AGRRDGTKLP TGAVQGRNDF       120
     GYAGFGGACP PKGDKPHHYQ FKVWALKTEK IPVDSNSSGA LVGYMLNANK IATAEITPVY       180
     EIK                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page