(data stored in ACNUC7421 zone)

EMBL: AM946981.YBCQ

AM946981.YBCQ        Location/Qualifiers
FT   CDS             542545..542928
FT                   /transl_table=11
FT                   /gene="ybcQ"
FT                   /locus_tag="B21_00507"
FT                   /product="DLP12 prophage; predicted antitermination
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00507"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31024"
FT                   /protein_id="CAQ31024.1"
FT                   /translation="MRDIQMVLERWGAWAANNHEDVTWSSIAAGFKGLIPSKVKSRPQC
FT                   CDDDAMIICGCMARLKKNNSDLHDLLVDYYVVGMTFMSLAGKHCCSDGYIGKRLQKAEG
FT                   IIEGMLMALDIRLEMDIVVNNSN"
     MRDIQMVLER WGAWAANNHE DVTWSSIAAG FKGLIPSKVK SRPQCCDDDA MIICGCMARL        60
     KKNNSDLHDL LVDYYVVGMT FMSLAGKHCC SDGYIGKRLQ KAEGIIEGML MALDIRLEMD       120
     IVVNNSN                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page