(data stored in ACNUC7421 zone)

EMBL: AM946981.YBDD

AM946981.YBDD        Location/Qualifiers
FT   CDS             592652..592849
FT                   /transl_table=11
FT                   /gene="ybdD"
FT                   /locus_tag="B21_00555"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00555"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31072"
FT                   /protein_id="CAQ31072.1"
FT                   /translation="MFDSLAKAGKYLGQAAKLMIGMPDYDNYVEHMRVNHPDQTPMTYE
FT                   EFFRERQDARYGGKGGARCC"
     MFDSLAKAGK YLGQAAKLMI GMPDYDNYVE HMRVNHPDQT PMTYEEFFRE RQDARYGGKG        60
     GARCC                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page