(data stored in ACNUC7421 zone)

EMBL: AM946981.YBDF

AM946981.YBDF        Location/Qualifiers
FT   CDS             complement(564181..564549)
FT                   /transl_table=11
FT                   /gene="ybdF"
FT                   /locus_tag="B21_00529"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00529"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31046"
FT                   /protein_id="CAQ31046.1"
FT                   /translation="MDKQSLHETAKRLALELPFVELCWPFGPEFDVFKIGGKIFMLSSE
FT                   LRGVPFINLKSDPQKSLLNQQIYPSIKPGYHMNKKHWISVYPGEEISEALLRDLINDSW
FT                   NLVVDGLAKRDQKRVRPG"
     MDKQSLHETA KRLALELPFV ELCWPFGPEF DVFKIGGKIF MLSSELRGVP FINLKSDPQK        60
     SLLNQQIYPS IKPGYHMNKK HWISVYPGEE ISEALLRDLI NDSWNLVVDG LAKRDQKRVR       120
     PG                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page