(data stored in SCRATCH zone)

EMBL: AM946981.YBDM

AM946981.YBDM        Location/Qualifiers
FT   CDS             complement(595217..595846)
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="B21_00558"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00558"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31075"
FT                   /protein_id="CAQ31075.1"
FT                   /translation="MGDTMQQRLTQDLTQFLASLPEDDRIKAINEIRMAIHQVSPFREE
FT                   PVDCVLWVKNDQLVPNDYNPNNVAPPEKKLLKKSIEIDGFTQPIVVTHTDKNALEIVDG
FT                   FHRHEIGKGSSSLKLRLKGYLPVTCLEGTRNQRIAATIRHNRARGRHQITAMSEIVREL
FT                   SQLGWDDNKIGKELGMDSDEVLRLKQINGLQELFADRQYSRAWTVK"
     MGDTMQQRLT QDLTQFLASL PEDDRIKAIN EIRMAIHQVS PFREEPVDCV LWVKNDQLVP        60
     NDYNPNNVAP PEKKLLKKSI EIDGFTQPIV VTHTDKNALE IVDGFHRHEI GKGSSSLKLR       120
     LKGYLPVTCL EGTRNQRIAA TIRHNRARGR HQITAMSEIV RELSQLGWDD NKIGKELGMD       180
     SDEVLRLKQI NGLQELFADR QYSRAWTVK                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page