(data stored in ACNUC7421 zone)

EMBL: AM946981.YBEB

AM946981.YBEB        Location/Qualifiers
FT   CDS             complement(629076..629393)
FT                   /transl_table=11
FT                   /gene="ybeB"
FT                   /locus_tag="B21_00595"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00595"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31112"
FT                   /protein_id="CAQ31112.1"
FT                   /translation="MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSS
FT                   RHVMSIADHVVQESRAAGLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLW
FT                   S"
     MQGKALQDFV IDKIDDLKGQ DIIALDVQGK SSITDCMIIC TGTSSRHVMS IADHVVQESR        60
     AAGLLPLGVE GENSADWIVV DLGDVIVHVM QEESRRLYEL EKLWS                       105
//

If you have problems or comments...

PBIL Back to PBIL home page